PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10003317m
Common NameCICLE_v10003317mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 547aa    MW: 60682 Da    PI: 6.419
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10003317mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B366.34.4e-21127228199
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+k+lt sd++++g +++  ++a+++        +++   ++l+ +d++g++W++++i+r +++r++lt GW+ Fv++++L +gD ++F   + 
  Ciclev10003317m 127 FCKTLTASDTSTHGGFSVLHRHADDClppldmsRQPP--WQELVATDLHGNEWNFRHIFRDQPRRHLLTIGWSVFVSSKKLVAGDAFIFL--RG 216
                      99****************************9743333..358************************************************..34 PP

                      SEE..EEEEE-S CS
               B3  88 sefelvvkvfrk 99 
                      +++el+v+v+r+
  Ciclev10003317m 217 ENEELRVGVRRH 228
                      88889****996 PP

2Auxin_resp107.41.6e-35253335183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha++t++ F+++Y+Pr+s+seF+v+v+k+++a k+k+svGm fkm fe+e+++e+r+sGt+vgv d++++ Wp+S+WrsLk
  Ciclev10003317m 253 ASHAIATGTLFSIFYKPRTSRSEFIVSVNKYLEAKKHKLSVGMGFKMTFEGEEVPEQRFSGTIVGVGDCKSSVWPDSEWRSLK 335
                      789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.4E-40117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.7E-39124242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.56E-18125227No hitNo description
SMARTSM010196.7E-22127229IPR003340B3 DNA binding domain
PfamPF023625.7E-19127228IPR003340B3 DNA binding domain
PROSITE profilePS5086310.602127229IPR003340B3 DNA binding domain
PfamPF065075.9E-34253335IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MSFAAAAVPL NHASGGGSND ALYRELWHAC AGPLATLPCE GQRVYYFPQG HMEQLEASMH  60
QELEQQMPSF NLPSKILCKV VNVQRRAEPE TDEVYAQITL LPEPDQSEVT SPDPPIPEPE  120
KCTVHSFCKT LTASDTSTHG GFSVLHRHAD DCLPPLDMSR QPPWQELVAT DLHGNEWNFR  180
HIFRDQPRRH LLTIGWSVFV SSKKLVAGDA FIFLRGENEE LRVGVRRHMR QQTNMPSSVI  240
SSHSMHLGVL AIASHAIATG TLFSIFYKPR TSRSEFIVSV NKYLEAKKHK LSVGMGFKMT  300
FEGEEVPEQR FSGTIVGVGD CKSSVWPDSE WRSLKVQWDE PSSILRPDRV SSWELEPLVA  360
TTTTTNAQPA QRNKRSRPPV LPSPAAWDEP SSILRPDRVS SWELEPLVAT TTTTNAQTAQ  420
RNKRSRPPVS PSPAADISVL ENLTESFAPV VNKESSEKRQ GNGNTCRQFG IPHIDNSNVE  480
EASPAFTMSG AMGDDRAIPC LDADSDQHSE PSNINRSDVP SVSCDAEKSC PRSPQESQSR  540
QIRSCTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.0113585355Auxin response factor 1
4ldw_A0.0113585355Auxin response factor 1
4ldw_B0.0113585355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006431458.10.0hypothetical protein CICLE_v10003317mg, partial
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLV4SAZ20.0V4SAZ2_9R
STRINGGLYMA16G00220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88252227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.30.0auxin response factor 1